| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330995.1 | 5prime_partial | 207 | 1-624(+) |
Amino Acid sequence : | |||
| FNLYKQGFLQLNDVHIFGYSRTKLSDDELRDRIRGYLPSGDEVGGDVSSFLQLIKYVSGSYDSPEGFQELDNAISKHEISKNSTEGSCRRLFYLALPPSVYPQVCRMIKNHCMNKADFGG WTRIVVEKPFGKDLASAEELSSQIGELFDEPQIYRIDHYLGKELVQNLLVLRFANRFFLPLWNRDNIANVQIVFREDFGTERPRWIF* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,999.900 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 54.028 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.246 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330995.1 | 5prime_partial | 207 | 1-624(+) |
Amino Acid sequence : | |||
| FNLYKQGFLQLNDVHIFGYSRTKLSDDELRDRIRGYLPSGDEVGGDVSSFLQLIKYVSGSYDSPEGFQELDNAISKHEISKNSTEGSCRRLFYLALPPSVYPQVCRMIKNHCMNKADFGG WTRIVVEKPFGKDLASAEELSSQIGELFDEPQIYRIDHYLGKELVQNLLVLRFANRFFLPLWNRDNIANVQIVFREDFGTERPRWIF* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,999.900 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 54.028 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.246 | ||
| sheet | 0.217 | ||