Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330998.1 | complete | 112 | 37-375(+) |
Amino Acid sequence : | |||
MASFEEAPPGNKDAGAKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,213.855 | ||
Theoretical pI: | 9.345 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 36.056 | ||
aromaticity | 0.098 | ||
GRAVY | -0.604 | ||
Secondary Structure Fraction | |||
Helix | 0.232 | ||
turn | 0.268 | ||
sheet | 0.259 |