Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331003.1	complete	164	62-556(+)
Amino Acid sequence :
MDFKNLLRVSPCFFQKYGLTPPQEVKLRVHSGRTWIVGVERLDGVFCFTEGWPDFVHDCGLQLGEFVVFTLLPESKFKVEIYDTSFCQREIPLGANVKQKRKRRAVGDPLFFQLLLKKQH RSRITLPKNFWEKAGLGREKCVMVEYGGAGERSCTCVALRVGLT*
Physicochemical properties
Number of amino acids:		164
Molecular weight:		18,816.818
Theoretical pI:		9.373
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21345
Instability index:		38.626
aromaticity		0.116
GRAVY		-0.176
Secondary Structure Fraction
Helix		0.348
turn		0.195
sheet		0.220