| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331012.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
| RNRGSKHAGKDEYVKTSSAAAGGSRKESAGEADIIIVGAGVAGAALAYTLGKDGRRVRVIERDLTEPDRIVGELLQPGGYLKLIELGLEDCVSDIDAQRVFGYALYKDGKDTKLSYPLEN FDSDISGRSFHNGRFIQRMREKAATLSNVRLEQGTVTSLLEEEGTVKGVQYKTKNGEEITAYAPLTIVCDGCFST* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,111.465 | ||
| Theoretical pI: | 5.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 28.943 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.231 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331012.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
| RNRGSKHAGKDEYVKTSSAAAGGSRKESAGEADIIIVGAGVAGAALAYTLGKDGRRVRVIERDLTEPDRIVGELLQPGGYLKLIELGLEDCVSDIDAQRVFGYALYKDGKDTKLSYPLEN FDSDISGRSFHNGRFIQRMREKAATLSNVRLEQGTVTSLLEEEGTVKGVQYKTKNGEEITAYAPLTIVCDGCFST* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,111.465 | ||
| Theoretical pI: | 5.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 28.943 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.231 | ||
| sheet | 0.262 | ||