Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331017.1 | 5prime_partial | 205 | 625-8(-) |
Amino Acid sequence : | |||
AQASRKSSPRVNNEAVKKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKITEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGE QLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAY* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,251.345 | ||
Theoretical pI: | 9.583 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 47.397 | ||
aromaticity | 0.083 | ||
GRAVY | -0.557 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.215 | ||
sheet | 0.249 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331017.1 | 5prime_partial | 205 | 625-8(-) |
Amino Acid sequence : | |||
AQASRKSSPRVNNEAVKKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKITEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGE QLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAY* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,251.345 | ||
Theoretical pI: | 9.583 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 47.397 | ||
aromaticity | 0.083 | ||
GRAVY | -0.557 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.215 | ||
sheet | 0.249 |