| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331018.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| LEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDEEFKSWLAFAAQKIVEVNALAKALCGQKDEAFFSANAAAQASRKSSPRVNNEAVKKAAAALRGSDHRRATNVSARLDAQQKKLNLPIL PTTTIGSFPQTVELRRVRREFKAKKITEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVYW | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 25,604.895 | ||
| Theoretical pI: | 8.738 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 37.966 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.204 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331018.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| LEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDEEFKSWLAFAAQKIVEVNALAKALCGQKDEAFFSANAAAQASRKSSPRVNNEAVKKAAAALRGSDHRRATNVSARLDAQQKKLNLPIL PTTTIGSFPQTVELRRVRREFKAKKITEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVYW | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 25,604.895 | ||
| Theoretical pI: | 8.738 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 37.966 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.204 | ||
| sheet | 0.287 | ||