| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331025.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
| CTLSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIA QGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYL DDKTIFHLNPSGRVVIGGPHGDAG | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 28,818.267 | ||
| Theoretical pI: | 5.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 35.686 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.216 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331025.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
| CTLSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIA QGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYL DDKTIFHLNPSGRVVIGGPHGDAG | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 28,818.267 | ||
| Theoretical pI: | 5.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 35.686 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.216 | ||
| sheet | 0.212 | ||