| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331042.1 | 5prime_partial | 176 | 3-533(+) |
Amino Acid sequence : | |||
| SQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALDNGDNEKNVSTSIFHKIEAFEEELKALLPKEVESARIAVESGNPAIANRIVECRSYPL YRFIREELGASFLTGEKAISPGEECDRVFTALSKGLIVDPLLECLHGWNGAPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,651.259 | ||
| Theoretical pI: | 5.168 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 36.397 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.216 | ||
| sheet | 0.307 | ||