| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331047.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
| RPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNF NDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKIRGGEPGPGEHGCCCQA | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 11,804.652 | ||
| Theoretical pI: | 9.043 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 67.829 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.336 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331047.1 | 5prime_partial | 107 | 673-350(-) |
Amino Acid sequence : | |||
| GAWQQQPCSPGPGSPPRILRVLRPQSGFTHKMLLSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSEREFSIVITSASMLMMEWMMSLKLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,804.652 | ||
| Theoretical pI: | 9.043 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 67.829 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.336 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331047.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
| RPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNF NDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKIRGGEPGPGEHGCCCQA | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 11,804.652 | ||
| Theoretical pI: | 9.043 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 67.829 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.336 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331047.1 | 5prime_partial | 107 | 673-350(-) |
Amino Acid sequence : | |||
| GAWQQQPCSPGPGSPPRILRVLRPQSGFTHKMLLSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSEREFSIVITSASMLMMEWMMSLKLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,804.652 | ||
| Theoretical pI: | 9.043 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 67.829 | ||
| aromaticity | 0.084 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.336 | ||
| sheet | 0.262 | ||