| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331048.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
| ENFNFNMLNLEARSNENVTKSPLSNVIYNMNAVYQNPNIISMGHISGSKYNNIISPPKEPNNMQTNNSSNKDDAMNANSAADKRFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRQL FGLPPRYRDSVRAITPGLPLFLYNYTTHQLHGIFEATTFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRKLCKPLEEDAFRPVLHHYDGPKFRLELSVPETLDLLDLCKQAGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,364.543 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
| Instability index: | 42.056 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.292 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331048.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
| ENFNFNMLNLEARSNENVTKSPLSNVIYNMNAVYQNPNIISMGHISGSKYNNIISPPKEPNNMQTNNSSNKDDAMNANSAADKRFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRQL FGLPPRYRDSVRAITPGLPLFLYNYTTHQLHGIFEATTFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRKLCKPLEEDAFRPVLHHYDGPKFRLELSVPETLDLLDLCKQAGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,364.543 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
| Instability index: | 42.056 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.292 | ||
| sheet | 0.240 | ||