| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331050.1 | 3prime_partial | 165 | 154-648(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGK TQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHV | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 15,200.592 | ||
| Theoretical pI: | 7.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.507 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.433 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.229 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331050.1 | 3prime_partial | 144 | 432-1(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIENRVGD LIAELVGVPLIHALGGKQEGVRLF | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,200.592 | ||
| Theoretical pI: | 7.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.507 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.433 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.229 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331050.1 | 3prime_partial | 165 | 154-648(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGK TQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHV | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 15,200.592 | ||
| Theoretical pI: | 7.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.507 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.433 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.229 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331050.1 | 3prime_partial | 144 | 432-1(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIENRVGD LIAELVGVPLIHALGGKQEGVRLF | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,200.592 | ||
| Theoretical pI: | 7.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.507 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.433 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.229 | ||
| sheet | 0.292 | ||