Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331055.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
RRRNTAPLVVVASVSSNHNPADGNVVLVENTLNGATENALTISSPVIKKSTVGDGVEELYGEDGASEDQYVTPWAVSVASGYPLLRDPRYNKGLAFNEKERDGHFLRGLLPPVVVSQDLQ VKKMMHNIRQYQVPLQRYMAMMDLQERNERLFYKLLIDYVEELLPVVYTPTVGEACQKYGSIFGQPQGLFISLKEKGRILDVLK | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,852.890 | ||
Theoretical pI: | 6.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
Instability index: | 51.660 | ||
aromaticity | 0.078 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.245 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331055.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
RRRNTAPLVVVASVSSNHNPADGNVVLVENTLNGATENALTISSPVIKKSTVGDGVEELYGEDGASEDQYVTPWAVSVASGYPLLRDPRYNKGLAFNEKERDGHFLRGLLPPVVVSQDLQ VKKMMHNIRQYQVPLQRYMAMMDLQERNERLFYKLLIDYVEELLPVVYTPTVGEACQKYGSIFGQPQGLFISLKEKGRILDVLK | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,852.890 | ||
Theoretical pI: | 6.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
Instability index: | 51.660 | ||
aromaticity | 0.078 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.245 | ||
sheet | 0.260 |