| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331055.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
| RRRNTAPLVVVASVSSNHNPADGNVVLVENTLNGATENALTISSPVIKKSTVGDGVEELYGEDGASEDQYVTPWAVSVASGYPLLRDPRYNKGLAFNEKERDGHFLRGLLPPVVVSQDLQ VKKMMHNIRQYQVPLQRYMAMMDLQERNERLFYKLLIDYVEELLPVVYTPTVGEACQKYGSIFGQPQGLFISLKEKGRILDVLK | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,852.890 | ||
| Theoretical pI: | 6.374 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 51.660 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.245 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331055.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
| RRRNTAPLVVVASVSSNHNPADGNVVLVENTLNGATENALTISSPVIKKSTVGDGVEELYGEDGASEDQYVTPWAVSVASGYPLLRDPRYNKGLAFNEKERDGHFLRGLLPPVVVSQDLQ VKKMMHNIRQYQVPLQRYMAMMDLQERNERLFYKLLIDYVEELLPVVYTPTVGEACQKYGSIFGQPQGLFISLKEKGRILDVLK | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,852.890 | ||
| Theoretical pI: | 6.374 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 51.660 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.245 | ||
| sheet | 0.260 | ||