| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331064.1 | 5prime_partial | 129 | 2-391(+) |
Amino Acid sequence : | |||
| GHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFYCPTVNIDRLWSLVPQEVKDKASKDNAPLLDVTQFGYFKVLGKGLLPADKPVVVKAKLVSKNAEKKIKE AGGAVVLTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 12,258.942 | ||
| Theoretical pI: | 11.960 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 104.163 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.939 | ||
Secondary Structure Fraction | |||
| Helix | 0.224 | ||
| turn | 0.262 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331064.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
| RPRSYRKTPQASRWSGKRRWYAPPPYPLRQVSPWILRQSRYALFPQAPQQVLLPHRQHRPPLVAGAARGEGQGLQGQRAAPRRHAVRLLQGFGERFAACGQACRREG* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,258.942 | ||
| Theoretical pI: | 11.960 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 104.163 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.939 | ||
Secondary Structure Fraction | |||
| Helix | 0.224 | ||
| turn | 0.262 | ||
| sheet | 0.234 | ||