Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331064.1 | 5prime_partial | 129 | 2-391(+) |
Amino Acid sequence : | |||
GHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFYCPTVNIDRLWSLVPQEVKDKASKDNAPLLDVTQFGYFKVLGKGLLPADKPVVVKAKLVSKNAEKKIKE AGGAVVLTA* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 12,258.942 | ||
Theoretical pI: | 11.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 104.163 | ||
aromaticity | 0.093 | ||
GRAVY | -0.939 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.262 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331064.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
RPRSYRKTPQASRWSGKRRWYAPPPYPLRQVSPWILRQSRYALFPQAPQQVLLPHRQHRPPLVAGAARGEGQGLQGQRAAPRRHAVRLLQGFGERFAACGQACRREG* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,258.942 | ||
Theoretical pI: | 11.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 104.163 | ||
aromaticity | 0.093 | ||
GRAVY | -0.939 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.262 | ||
sheet | 0.234 |