| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331070.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| SQNGRWQCAAAATTNPLPQLKSTAAAVQIAAFPTTLSRPSTTATKPLSITCSSTTLQTSTPAATATDRVFNFAAGPATLPENVLLKAQSELYNWRGSGMSVMEMSHRGKEFLSIIQKAES DLRNLLNIPSDYSVLFLQGGATTQFAAVPLNLCKPGDTVDYIVTGSWGDKAFKEAAKYCNPKSIWSGKSEKYTKIPKFDSLESTPGAKYLHICANETIHGVEFKSYPTPASENEILIADM SSNFCSKPVDVTKFGL | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 27,573.987 | ||
| Theoretical pI: | 8.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32805 | ||
| Instability index: | 32.624 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.273 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331070.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| SQNGRWQCAAAATTNPLPQLKSTAAAVQIAAFPTTLSRPSTTATKPLSITCSSTTLQTSTPAATATDRVFNFAAGPATLPENVLLKAQSELYNWRGSGMSVMEMSHRGKEFLSIIQKAES DLRNLLNIPSDYSVLFLQGGATTQFAAVPLNLCKPGDTVDYIVTGSWGDKAFKEAAKYCNPKSIWSGKSEKYTKIPKFDSLESTPGAKYLHICANETIHGVEFKSYPTPASENEILIADM SSNFCSKPVDVTKFGL | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 27,573.987 | ||
| Theoretical pI: | 8.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32805 | ||
| Instability index: | 32.624 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.273 | ||
| sheet | 0.254 | ||