| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331079.1 | 5prime_partial | 178 | 2-538(+) |
Amino Acid sequence : | |||
| DIGTSFTAIQGRGACSSFVFGFVTFMSIGGFPDFVEDMKVFRRERLNGHYGVGAFVISNTLSAMPFLITISLASGTICYYMVRFHSGFSHYAYFVLCLYGSVTVVESLMMVLASVIPNFL MGITIGSGIQGIFMLTSGFFRLPNDIPKPIWRYPVMYMSFHYWSLQVMYNQSMHACFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 12,402.465 | ||
| Theoretical pI: | 9.565 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33960 | ||
| Instability index: | 37.564 | ||
| aromaticity | 0.204 | ||
| GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.204 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331079.1 | complete | 103 | 43-354(+) |
Amino Acid sequence : | |||
| MFVFRLWFCDFHVHWRVSRFRGGYEGFPKGEAKWALRCGGVCYKQHFISYAFFDNHKFSFRNNLLLYGPFSLWLLALCILRIVSLWQCHRCRKPHDGPCKCHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,402.465 | ||
| Theoretical pI: | 9.565 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33960 | ||
| Instability index: | 37.564 | ||
| aromaticity | 0.204 | ||
| GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.204 | ||
| sheet | 0.175 | ||