Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331079.1 | 5prime_partial | 178 | 2-538(+) |
Amino Acid sequence : | |||
DIGTSFTAIQGRGACSSFVFGFVTFMSIGGFPDFVEDMKVFRRERLNGHYGVGAFVISNTLSAMPFLITISLASGTICYYMVRFHSGFSHYAYFVLCLYGSVTVVESLMMVLASVIPNFL MGITIGSGIQGIFMLTSGFFRLPNDIPKPIWRYPVMYMSFHYWSLQVMYNQSMHACFF* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 12,402.465 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33960 | ||
Instability index: | 37.564 | ||
aromaticity | 0.204 | ||
GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
Helix | 0.388 | ||
turn | 0.204 | ||
sheet | 0.175 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331079.1 | complete | 103 | 43-354(+) |
Amino Acid sequence : | |||
MFVFRLWFCDFHVHWRVSRFRGGYEGFPKGEAKWALRCGGVCYKQHFISYAFFDNHKFSFRNNLLLYGPFSLWLLALCILRIVSLWQCHRCRKPHDGPCKCHP* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,402.465 | ||
Theoretical pI: | 9.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33960 | ||
Instability index: | 37.564 | ||
aromaticity | 0.204 | ||
GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
Helix | 0.388 | ||
turn | 0.204 | ||
sheet | 0.175 |