| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331085.1 | 5prime_partial | 245 | 3-740(+) |
Amino Acid sequence : | |||
| RSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAACAYDRAAIKFRGVEADINFTLEDYQDDLQQMRNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGK KYVYLGLFDTEIEAARAYDKAAIKCNGKEAVTNFDASIYQEELKAAAEPSHRSADHDLDLSLGNSGSKPREADPDGHQITRHNYNNETETSQLLSHTHLNSLKPSNRFGRQLYTPFVASH NYQVN* | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,992.671 | ||
| Theoretical pI: | 8.793 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 45.272 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.220 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331085.1 | 5prime_partial | 245 | 3-740(+) |
Amino Acid sequence : | |||
| RSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAACAYDRAAIKFRGVEADINFTLEDYQDDLQQMRNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGK KYVYLGLFDTEIEAARAYDKAAIKCNGKEAVTNFDASIYQEELKAAAEPSHRSADHDLDLSLGNSGSKPREADPDGHQITRHNYNNETETSQLLSHTHLNSLKPSNRFGRQLYTPFVASH NYQVN* | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,992.671 | ||
| Theoretical pI: | 8.793 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 45.272 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.832 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.220 | ||
| sheet | 0.233 | ||