Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331086.1	complete	174	122-646(+)
Amino Acid sequence :
MGISRFIFLLCLSWNFLIWGTHQLQGSQHQVLLQLRKQLEYPKQLDYWLNSGIDLCFASTSQVNITCQDNIVTEIKIFGDMKTRPPTFDGFPHSPQTLSGNFSMDSLIATLSRLNGLRVL SLVSLGIWGPVPDKIHRLQSLEFLDLSWNFLYGSIPETFQELSTFKFSSLTGTS*
Physicochemical properties
Number of amino acids:		174
Molecular weight:		19,778.522
Theoretical pI:		6.393
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 32095
Instability index:		41.957
aromaticity		0.121
GRAVY		0.054
Secondary Structure Fraction
Helix		0.379
turn		0.270
sheet		0.213