| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331093.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| RFEPAPRPFLRRLPLAAMSTAVVKRVGTHNGSFHCDEALGCFMIRLTKKFSEAHVVRTRDPQVLETLDAVLDVGGVYDPAKHRYDHHQKGFEETFGHGFNTKLSSAGLVYKHFGKEIIAK ELQVDEDHPDVQRLFLAVYKNFMEAIDAIDNGINQYDTDQPPRYVNNTHLSSRVGKLNLDWTDVDQSSEKENEAFERAMALTGREFMDNLQSLARSWLPARSIVL | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 13,839.607 | ||
| Theoretical pI: | 4.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 36.415 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.258 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331093.1 | 3prime_partial | 128 | 386-3(-) |
Amino Acid sequence : | |||
| MVFINLQLLSNYLFPKMLVNKTGTAELSIEPMAESLFETLLVMIVPVFGRVVDPTHIKHSIQSFKNLRVAGANNVSFGEFFGEADHEAAEGFIAVEASIVCTHSLNDGGGHCSEREAAEE GSWGGLKA | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,839.607 | ||
| Theoretical pI: | 4.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 36.415 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.258 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331093.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| RFEPAPRPFLRRLPLAAMSTAVVKRVGTHNGSFHCDEALGCFMIRLTKKFSEAHVVRTRDPQVLETLDAVLDVGGVYDPAKHRYDHHQKGFEETFGHGFNTKLSSAGLVYKHFGKEIIAK ELQVDEDHPDVQRLFLAVYKNFMEAIDAIDNGINQYDTDQPPRYVNNTHLSSRVGKLNLDWTDVDQSSEKENEAFERAMALTGREFMDNLQSLARSWLPARSIVL | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 13,839.607 | ||
| Theoretical pI: | 4.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 36.415 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.258 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331093.1 | 3prime_partial | 128 | 386-3(-) |
Amino Acid sequence : | |||
| MVFINLQLLSNYLFPKMLVNKTGTAELSIEPMAESLFETLLVMIVPVFGRVVDPTHIKHSIQSFKNLRVAGANNVSFGEFFGEADHEAAEGFIAVEASIVCTHSLNDGGGHCSEREAAEE GSWGGLKA | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,839.607 | ||
| Theoretical pI: | 4.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 36.415 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.258 | ||
| sheet | 0.320 | ||