| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331097.1 | 5prime_partial | 196 | 2-592(+) |
Amino Acid sequence : | |||
| NLLLLQQSKMSVASSPSFPCIKLPTPSSPAPSSYSPPPSSSSSSPAFKFTIRSAQTDGPLRRPGVPSPVKPVPPSPSPPAAPPAASPPPPPAAAAVQGKNVVTLEFQRQKAKELQEYFKQ KKLEAIDQAPFFGFIPKNEISNGRWAMFGFAVGMLTEFATGSDFVDQVKNPPLQFRNSRSGMILFLILIMKSAFVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,012.070 | ||
| Theoretical pI: | 10.058 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 90.507 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.367 | ||
| sheet | 0.224 | ||