Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331106.1 | complete | 139 | 132-551(+) |
Amino Acid sequence : | |||
MCIGWWIAIQRVDLYTIYMQPAPETPKHTLVMLAPGIPTVKPVVNSGRVRLRPVVIVSSDGPGGEVAAGVENAPPHVLLLRGGRRRRSRRHRTGRHRQRSLVLAIASLSSIFDVQRLGEG FLKVFEAALRRWSGHNIIP* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,678.280 | ||
Theoretical pI: | 9.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 55.820 | ||
aromaticity | 0.076 | ||
GRAVY | -0.997 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.341 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331106.1 | 5prime_partial | 132 | 617-219(-) |
Amino Acid sequence : | |||
TRVPPKEKKKANRSEGMVLLDHLWDDVVAGPPPERGLKHLKKSFAQPLNIKDTGEGSNSKYQRSLSMPASPVTPGTPSPTSAKKENVWRSVFHPGSNLATRTVGANYYDRPEPNSPTVYD WLYSGDTRSKHH* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,678.280 | ||
Theoretical pI: | 9.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 55.820 | ||
aromaticity | 0.076 | ||
GRAVY | -0.997 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.341 | ||
sheet | 0.182 |