Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331114.1	complete	163	678-187(-)
Amino Acid sequence :
MKQIEAGKDELETSFHFEIEQLKAEIANKNESIKELEIKLHELKLNHDVLVDEKDVLNINIFELSKELSSKDDQIDQMSSHLQQLQVEHIDLMAGYEGERRKVEELRLKVEELEREVEKK QQIIIQGAEEKREAIRQLCFSLEHYRNGYHRLREVVSGNNVIC*
Physicochemical properties
Number of amino acids:		163
Molecular weight:		17,715.596
Theoretical pI:		4.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		40.888
aromaticity		0.098
GRAVY		0.779
Secondary Structure Fraction
Helix		0.516
turn		0.118
sheet		0.412

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331114.1	complete	153	229-690(+)
Amino Acid sequence :
MVAIPVVLEREAELPDRFAFLLRSLNDDLLLLLHLPFEFLDLQSQLLHFSTFPLVSSHEIDVLHLELLQMAAHLVDLIILRAQLLAEFEDVYIQNVFLVHQNVVVQLQLVELYLELLDGF VLVGDLSLQLLDFEMERSFQFVLPSLDLFHVVL*
Physicochemical properties
Number of amino acids:		153
Molecular weight:		17,715.596
Theoretical pI:		4.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		40.888
aromaticity		0.098
GRAVY		0.779
Secondary Structure Fraction
Helix		0.516
turn		0.118
sheet		0.412