Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331121.1 | 5prime_partial | 189 | 622-53(-) |
Amino Acid sequence : | |||
PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFTNAT GDQGYPGGKFFDPLSFAGTLKDGVYIPDLDKLDRLKLAEIKHARLAMLAMLIFYFEAGQGKTPLGALGL* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 20,718.446 | ||
Theoretical pI: | 4.883 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56950 56950 | ||
Instability index: | 18.488 | ||
aromaticity | 0.148 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.254 | ||
sheet | 0.312 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331121.1 | 5prime_partial | 189 | 622-53(-) |
Amino Acid sequence : | |||
PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFTNAT GDQGYPGGKFFDPLSFAGTLKDGVYIPDLDKLDRLKLAEIKHARLAMLAMLIFYFEAGQGKTPLGALGL* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 20,718.446 | ||
Theoretical pI: | 4.883 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56950 56950 | ||
Instability index: | 18.488 | ||
aromaticity | 0.148 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.254 | ||
sheet | 0.312 |