| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331125.1 | 5prime_partial | 181 | 3-548(+) |
Amino Acid sequence : | |||
| ELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINL VTSMIGHLLHHFNWAPPSGVSTDELDMGENPGLVTYMRTPLEAVPTPRLPSDLYKRIAVDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 16,097.178 | ||
| Theoretical pI: | 11.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 81.367 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.754 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.246 | ||
| sheet | 0.138 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331125.1 | 5prime_partial | 138 | 596-180(-) |
Amino Acid sequence : | |||
| KLGQTPRHNFDSNKRHLQVHSYTLVEIGGQSRSRHRLQWSPHIGNETRVLSHVQLVGAHSTGRSPVEVVQEVSYHRCHQIYTQLGTRAHSSSRTKWKKSKIVPFHVNILFQESLRPKLRR VLPHSRITGYRPHIDMHI* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 16,097.178 | ||
| Theoretical pI: | 11.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 81.367 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.754 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.246 | ||
| sheet | 0.138 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331125.1 | 5prime_partial | 181 | 3-548(+) |
Amino Acid sequence : | |||
| ELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINL VTSMIGHLLHHFNWAPPSGVSTDELDMGENPGLVTYMRTPLEAVPTPRLPSDLYKRIAVDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 16,097.178 | ||
| Theoretical pI: | 11.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 81.367 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.754 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.246 | ||
| sheet | 0.138 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331125.1 | 5prime_partial | 138 | 596-180(-) |
Amino Acid sequence : | |||
| KLGQTPRHNFDSNKRHLQVHSYTLVEIGGQSRSRHRLQWSPHIGNETRVLSHVQLVGAHSTGRSPVEVVQEVSYHRCHQIYTQLGTRAHSSSRTKWKKSKIVPFHVNILFQESLRPKLRR VLPHSRITGYRPHIDMHI* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 16,097.178 | ||
| Theoretical pI: | 11.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 81.367 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.754 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.246 | ||
| sheet | 0.138 | ||