Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331126.1	5prime_partial	187	709-146(-)
Amino Acid sequence :
QQKVQEELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGA QLGINLVTSMIGHLLHHFNWAPPSGVSTDELDMGENPGLVTYMRTPLEAVPTPRLPSDLYKRIAVDL*
Physicochemical properties
Number of amino acids:		187
Molecular weight:		17,077.358
Theoretical pI:		11.321
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		80.500
aromaticity		0.061
GRAVY		-0.746
Secondary Structure Fraction
Helix		0.279
turn		0.238
sheet		0.143

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331126.1	complete	147	71-514(+)
Amino Acid sequence :
MKSNKLQIQTRAKPQGTTFDSNKRHLQVHSYTLVEIGGQSRSRHRLQWSPHIGNETRVLSHVQLVGAHSTGRSPVEVVQEVSYHRCHQIYTQLGTRAHSSSRTKWKKSKIVPFHVNILFQ ESLRPKLRRVLPHSRITGYRPHIDMHI*
Physicochemical properties
Number of amino acids:		147
Molecular weight:		17,077.358
Theoretical pI:		11.321
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		80.500
aromaticity		0.061
GRAVY		-0.746
Secondary Structure Fraction
Helix		0.279
turn		0.238
sheet		0.143

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331126.1	5prime_partial	187	709-146(-)
Amino Acid sequence :
QQKVQEELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGA QLGINLVTSMIGHLLHHFNWAPPSGVSTDELDMGENPGLVTYMRTPLEAVPTPRLPSDLYKRIAVDL*
Physicochemical properties
Number of amino acids:		187
Molecular weight:		17,077.358
Theoretical pI:		11.321
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		80.500
aromaticity		0.061
GRAVY		-0.746
Secondary Structure Fraction
Helix		0.279
turn		0.238
sheet		0.143

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331126.1	complete	147	71-514(+)
Amino Acid sequence :
MKSNKLQIQTRAKPQGTTFDSNKRHLQVHSYTLVEIGGQSRSRHRLQWSPHIGNETRVLSHVQLVGAHSTGRSPVEVVQEVSYHRCHQIYTQLGTRAHSSSRTKWKKSKIVPFHVNILFQ ESLRPKLRRVLPHSRITGYRPHIDMHI*
Physicochemical properties
Number of amino acids:		147
Molecular weight:		17,077.358
Theoretical pI:		11.321
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		80.500
aromaticity		0.061
GRAVY		-0.746
Secondary Structure Fraction
Helix		0.279
turn		0.238
sheet		0.143