| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331127.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
| PPASPPLPILPNFTDTNASVSFTNQFRSLAYKNHQINVPMNVTTNLLFTISVNIRACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVPQI FWTSSNGTRVRVLDYNATVELVFQGTNIVAPSEHPMHLHGHNFYVVGSGFGNFNRARDAPNYNLVDPPFRNTIAVPRSGWTAIRFRANNPGVWLLHCHFERHITWGMEMAFITRNGRGPN ATMLPPPSEFPM | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 18,458.177 | ||
| Theoretical pI: | 9.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 70.976 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.159 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331127.1 | 3prime_partial | 157 | 473-3(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCPLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGEAAELVGEAHRRVGVGEIGEDWERRRRWR | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 18,458.177 | ||
| Theoretical pI: | 9.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 70.976 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.159 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331127.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
| PPASPPLPILPNFTDTNASVSFTNQFRSLAYKNHQINVPMNVTTNLLFTISVNIRACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVPQI FWTSSNGTRVRVLDYNATVELVFQGTNIVAPSEHPMHLHGHNFYVVGSGFGNFNRARDAPNYNLVDPPFRNTIAVPRSGWTAIRFRANNPGVWLLHCHFERHITWGMEMAFITRNGRGPN ATMLPPPSEFPM | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 18,458.177 | ||
| Theoretical pI: | 9.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 70.976 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.159 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331127.1 | 3prime_partial | 157 | 473-3(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCPLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGEAAELVGEAHRRVGVGEIGEDWERRRRWR | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 18,458.177 | ||
| Theoretical pI: | 9.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 70.976 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.159 | ||
| sheet | 0.223 | ||