| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331133.1 | internal | 200 | 3-602(+) |
Amino Acid sequence : | |||
| AAEEPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKEL KPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVGKRDGAFISTSS | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 22,241.611 | ||
| Theoretical pI: | 5.128 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 49.649 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.295 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331133.1 | internal | 200 | 3-602(+) |
Amino Acid sequence : | |||
| AAEEPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGVAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKEL KPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVGKRDGAFISTSS | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 22,241.611 | ||
| Theoretical pI: | 5.128 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 49.649 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.295 | ||
| sheet | 0.240 | ||