| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331135.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| ETLLHVSTAFVHGARVGVAPEQPLRMGQTLPGAKIPILDINLEKDIIEERLRFLQSQKLSDKEITRSMKDLGVERAMLHGWPNTYVFTKAMGEMMLEGFKGKCKVIIIRPTIITSTFKDP FPGWIEGVRTLDSIFVGYGKGKLKFFVGDPETISDLIPGDMVINCVIAAMAVNSSDKQQDLFVYQIGSSRRNPAKYEEIKWIMHRYLSKNPFLDDGGKPITVGYPFTLNSMATFHNYISL RYSLFLLILRLINLINGNYFQ | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,568.213 | ||
| Theoretical pI: | 9.085 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 37.342 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.234 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331135.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| ETLLHVSTAFVHGARVGVAPEQPLRMGQTLPGAKIPILDINLEKDIIEERLRFLQSQKLSDKEITRSMKDLGVERAMLHGWPNTYVFTKAMGEMMLEGFKGKCKVIIIRPTIITSTFKDP FPGWIEGVRTLDSIFVGYGKGKLKFFVGDPETISDLIPGDMVINCVIAAMAVNSSDKQQDLFVYQIGSSRRNPAKYEEIKWIMHRYLSKNPFLDDGGKPITVGYPFTLNSMATFHNYISL RYSLFLLILRLINLINGNYFQ | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,568.213 | ||
| Theoretical pI: | 9.085 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 37.342 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.234 | ||
| sheet | 0.230 | ||