| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331141.1 | 5prime_partial | 225 | 755-78(-) |
Amino Acid sequence : | |||
| KLRPIPIGFSNNLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAASGRPIQDVIQTDAAINPGNSGGPLLDSAGNLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVKFGKVTR PILGIKFAPDQSVEQLGVSGVLVLDAPPNGPAGKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCEVGDKVIVEVLRGDKLEKIPVVLEPKPDES* | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 23,323.462 | ||
| Theoretical pI: | 6.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 22.712 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.329 | ||
| sheet | 0.187 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331141.1 | 5prime_partial | 225 | 755-78(-) |
Amino Acid sequence : | |||
| KLRPIPIGFSNNLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAASGRPIQDVIQTDAAINPGNSGGPLLDSAGNLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVKFGKVTR PILGIKFAPDQSVEQLGVSGVLVLDAPPNGPAGKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCEVGDKVIVEVLRGDKLEKIPVVLEPKPDES* | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 23,323.462 | ||
| Theoretical pI: | 6.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 22.712 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.329 | ||
| sheet | 0.187 | ||