| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331155.1 | internal | 228 | 686-3(-) |
Amino Acid sequence : | |||
| HEGSCYGDAEREHQLRFDLRRVKGLEVRKMLEDGNCLFRAVADQVYGDSELYDLVRQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALSEMYNRPIHIYSYSTEPINI FHGNYNTDTPPIRLSYHHGNHYNSLVDPRRLTVGAGLGFSSLQGTNVDKDKVKAAIKAQQDQQIDNALLAEGRFYSDLELTEKEIERMVMEASRAEYLSDDQFKQHVG | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,548.315 | ||
| Theoretical pI: | 5.738 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 21110 | ||
| Instability index: | 44.228 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.770 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.197 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331155.1 | internal | 228 | 686-3(-) |
Amino Acid sequence : | |||
| HEGSCYGDAEREHQLRFDLRRVKGLEVRKMLEDGNCLFRAVADQVYGDSELYDLVRQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALSEMYNRPIHIYSYSTEPINI FHGNYNTDTPPIRLSYHHGNHYNSLVDPRRLTVGAGLGFSSLQGTNVDKDKVKAAIKAQQDQQIDNALLAEGRFYSDLELTEKEIERMVMEASRAEYLSDDQFKQHVG | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,548.315 | ||
| Theoretical pI: | 5.738 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 21110 | ||
| Instability index: | 44.228 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.770 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.197 | ||
| sheet | 0.241 | ||