| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331156.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
| SCYGDAEREHQFEIDLRRVKGLEVRKMLEDGNCLFRAVADQVYGDSELYDLVRQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALSEMYNRPIHIYSYSTEPINIFHG NYNTDTPPIRLSYHHGNHYNSLVDPRRLTVGAGLGFSSLQGTNVDKDKVKAAIKAQQDQQIDNALLAEGRFYSDLDLTEKEIERMVMEASRAEYLSDDQFKQHVGPRESST | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 26,841.585 | ||
| Theoretical pI: | 5.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 21110 | ||
| Instability index: | 44.264 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.203 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331156.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
| SCYGDAEREHQFEIDLRRVKGLEVRKMLEDGNCLFRAVADQVYGDSELYDLVRQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQALSEMYNRPIHIYSYSTEPINIFHG NYNTDTPPIRLSYHHGNHYNSLVDPRRLTVGAGLGFSSLQGTNVDKDKVKAAIKAQQDQQIDNALLAEGRFYSDLDLTEKEIERMVMEASRAEYLSDDQFKQHVGPRESST | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 26,841.585 | ||
| Theoretical pI: | 5.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 21110 | ||
| Instability index: | 44.264 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.203 | ||
| sheet | 0.234 | ||