| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331165.1 | internal | 224 | 674-3(-) |
Amino Acid sequence : | |||
| RAGPCPKWDSTFNLILHDNTGTLKFHLYQCTASIKYDYLTSCEIKMRYVSDDSTIFWAIGDDLSVIARHAEFCGDEVEMTLPFEGANLGVLTVRLVLKEWMFSDGSHSSANINASSHHSL SGSSNYFPKTGRKICITVVEGKDLLVKDKITKSEPYVKLQYGKAIQKTKPAPHSSNPTWNQRFEFDEIGGGEYLTIKCFTEETLGDESIGSARVNLEGLVEGSV | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 12,020.072 | ||
| Theoretical pI: | 10.109 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 44.481 | ||
| aromaticity | 0.220 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.180 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331165.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| YRTFYKSFQIHTCTANALIAKCFLCKAFYRQVFPTSYFVEFKPLIPSRIRRMWGRFCFLDGLAILQFNIWFRFRNLVLHKEVFALNHSYANFPSSFGKII* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 12,020.072 | ||
| Theoretical pI: | 10.109 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 44.481 | ||
| aromaticity | 0.220 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.180 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331165.1 | internal | 224 | 674-3(-) |
Amino Acid sequence : | |||
| RAGPCPKWDSTFNLILHDNTGTLKFHLYQCTASIKYDYLTSCEIKMRYVSDDSTIFWAIGDDLSVIARHAEFCGDEVEMTLPFEGANLGVLTVRLVLKEWMFSDGSHSSANINASSHHSL SGSSNYFPKTGRKICITVVEGKDLLVKDKITKSEPYVKLQYGKAIQKTKPAPHSSNPTWNQRFEFDEIGGGEYLTIKCFTEETLGDESIGSARVNLEGLVEGSV | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 12,020.072 | ||
| Theoretical pI: | 10.109 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 44.481 | ||
| aromaticity | 0.220 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.180 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331165.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| YRTFYKSFQIHTCTANALIAKCFLCKAFYRQVFPTSYFVEFKPLIPSRIRRMWGRFCFLDGLAILQFNIWFRFRNLVLHKEVFALNHSYANFPSSFGKII* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 12,020.072 | ||
| Theoretical pI: | 10.109 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 44.481 | ||
| aromaticity | 0.220 | ||
| GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.180 | ||
| sheet | 0.190 | ||