| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331166.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
| RAGPCPKWDSTFNLILHDNTGTLKFHLYQCTASIKYDYLTSCEIKMRYVSDDSTIFWAIGDDLSVIARHAEFCGDEVEMTLPFEGANLGVLTVRLVLKEWMFSDGSHSSANINASSHHSL SGSSNYFPKTGRKICITVVEGKDLLVKDKITKSEPYVKLQYGKAIQKTKPAPHSSNPTWNQRFEFDEIGGGEYLTIKCFTEETLGDESIGSARVNLEGLVEGSVRDVYILL | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 12,806.856 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 43.867 | ||
| aromaticity | 0.206 | ||
| GRAVY | 0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.187 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331166.1 | 5prime_partial | 107 | 695-372(-) |
Amino Acid sequence : | |||
| EENVDISYRTFYKSFQIHTCTANALIAKCFLCKAFYRQVFPTSYFVEFKPLIPSRIRRMWGRFCFLDGLAILQFNIWFRFRNLVLHKEVFALNHSYANFPSSFGKII* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,806.856 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 43.867 | ||
| aromaticity | 0.206 | ||
| GRAVY | 0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.187 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331166.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
| RAGPCPKWDSTFNLILHDNTGTLKFHLYQCTASIKYDYLTSCEIKMRYVSDDSTIFWAIGDDLSVIARHAEFCGDEVEMTLPFEGANLGVLTVRLVLKEWMFSDGSHSSANINASSHHSL SGSSNYFPKTGRKICITVVEGKDLLVKDKITKSEPYVKLQYGKAIQKTKPAPHSSNPTWNQRFEFDEIGGGEYLTIKCFTEETLGDESIGSARVNLEGLVEGSVRDVYILL | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 12,806.856 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 43.867 | ||
| aromaticity | 0.206 | ||
| GRAVY | 0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.187 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331166.1 | 5prime_partial | 107 | 695-372(-) |
Amino Acid sequence : | |||
| EENVDISYRTFYKSFQIHTCTANALIAKCFLCKAFYRQVFPTSYFVEFKPLIPSRIRRMWGRFCFLDGLAILQFNIWFRFRNLVLHKEVFALNHSYANFPSSFGKII* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,806.856 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 43.867 | ||
| aromaticity | 0.206 | ||
| GRAVY | 0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.187 | ||
| sheet | 0.196 | ||