| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331171.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| PTTRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVT TTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALXQALSPG | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 10,746.444 | ||
| Theoretical pI: | 10.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 49.693 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331171.1 | 3prime_partial | 99 | 298-2(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPRRG | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,746.444 | ||
| Theoretical pI: | 10.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 49.693 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331171.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| PTTRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVT TTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALXQALSPG | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 10,746.444 | ||
| Theoretical pI: | 10.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 49.693 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331171.1 | 3prime_partial | 99 | 298-2(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPRRG | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,746.444 | ||
| Theoretical pI: | 10.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 49.693 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.273 | ||
| sheet | 0.263 | ||