| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331174.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| FLHSFLLFPFSSPHTFNLPTMSAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVETNRRALRELLFTAPGALQYLSGVILFEETLYQKTAAGKPFVDVLNEGGVLP GIKVDKGTVELAGTDGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVPIVEPEILVDGSHDINKCADVTERVLAAVYKALNDHHVLLE GTLLKPNMGTPGSLSAKV | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 11,412.067 | ||
| Theoretical pI: | 10.574 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 47.548 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331174.1 | 5prime_partial | 104 | 774-460(-) |
Amino Acid sequence : | |||
| TLADKEPGVPMLGFNNVPSKRTWWSLRALYTAARTRSVTSAHLLMSWEPSTRISGSTIGTKPFSWQMMAYRARPLAFSLIESCDGSLGPIFSTALHLAKRAPAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,412.067 | ||
| Theoretical pI: | 10.574 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 47.548 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331174.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| FLHSFLLFPFSSPHTFNLPTMSAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVETNRRALRELLFTAPGALQYLSGVILFEETLYQKTAAGKPFVDVLNEGGVLP GIKVDKGTVELAGTDGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVPIVEPEILVDGSHDINKCADVTERVLAAVYKALNDHHVLLE GTLLKPNMGTPGSLSAKV | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 11,412.067 | ||
| Theoretical pI: | 10.574 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 47.548 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331174.1 | 5prime_partial | 104 | 774-460(-) |
Amino Acid sequence : | |||
| TLADKEPGVPMLGFNNVPSKRTWWSLRALYTAARTRSVTSAHLLMSWEPSTRISGSTIGTKPFSWQMMAYRARPLAFSLIESCDGSLGPIFSTALHLAKRAPAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,412.067 | ||
| Theoretical pI: | 10.574 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 47.548 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.288 | ||