| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331184.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| LAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPI PLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNIEIMPPAGLKGV | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,083.798 | ||
| Theoretical pI: | 5.583 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40575 | ||
| Instability index: | 58.653 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.237 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331184.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| LAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPI PLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNIEIMPPAGLKGV | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,083.798 | ||
| Theoretical pI: | 5.583 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40575 | ||
| Instability index: | 58.653 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.237 | ||
| sheet | 0.306 | ||