| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331193.1 | 5prime_partial | 192 | 647-69(-) |
Amino Acid sequence : | |||
| RAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTG KVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,076.119 | ||
| Theoretical pI: | 5.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 20.173 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.198 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331193.1 | 5prime_partial | 192 | 647-69(-) |
Amino Acid sequence : | |||
| RAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTG KVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,076.119 | ||
| Theoretical pI: | 5.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 20.173 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.198 | ||
| sheet | 0.292 | ||