| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331220.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| RNGKPHKILDRISGYAEAGTLTALIGPSGSGKTTLLDALAGRLAPDTFVSGAVLLNGRKAKLSFGTVAYVTQDENLIGTLTVRETIAYSARLRLPDSTPLSERNSIIENTIVEMGLEDCA DTVIGNWHLRGISGGERRRVSIAIELLMRPRLLFLDEPTSGLDSAAAFFVTQTLRGLANGKRTVIASIHQPSSEVFELFDRLCLLSGGRTVYFGEASQAYEFFASAGFPCPDLVTPVITL CV | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 14,609.021 | ||
| Theoretical pI: | 11.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 89.144 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.293 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331220.1 | complete | 133 | 444-43(-) |
Amino Acid sequence : | |||
| MRSSMAMLTRRLSPPLMPRRCQFPMTVSAQSSSPISTIVFSMMEFLSDSGVLSGRRSRAEYAIVSRTVRVPIRFSSCVTYATVPKDNLALRPLRRTAPETKVSGARRPAKASRSVVLPEP EGPMRAVRVPASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,609.021 | ||
| Theoretical pI: | 11.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 89.144 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.293 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331220.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| RNGKPHKILDRISGYAEAGTLTALIGPSGSGKTTLLDALAGRLAPDTFVSGAVLLNGRKAKLSFGTVAYVTQDENLIGTLTVRETIAYSARLRLPDSTPLSERNSIIENTIVEMGLEDCA DTVIGNWHLRGISGGERRRVSIAIELLMRPRLLFLDEPTSGLDSAAAFFVTQTLRGLANGKRTVIASIHQPSSEVFELFDRLCLLSGGRTVYFGEASQAYEFFASAGFPCPDLVTPVITL CV | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 14,609.021 | ||
| Theoretical pI: | 11.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 89.144 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.293 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331220.1 | complete | 133 | 444-43(-) |
Amino Acid sequence : | |||
| MRSSMAMLTRRLSPPLMPRRCQFPMTVSAQSSSPISTIVFSMMEFLSDSGVLSGRRSRAEYAIVSRTVRVPIRFSSCVTYATVPKDNLALRPLRRTAPETKVSGARRPAKASRSVVLPEP EGPMRAVRVPASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,609.021 | ||
| Theoretical pI: | 11.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 89.144 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.293 | ||
| sheet | 0.263 | ||