| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331227.1 | complete | 139 | 480-61(-) |
Amino Acid sequence : | |||
| MCIGWWIAIQRVDLYTIYMQPAPETPKHTLVMLAPGIPTVKPVVNSGRVRLRPVVIVSSDGPGGEVAAGVENAPPHVLLLRGGRRRRSRRHRTGRHRQRSLVLAIASLSSIFDVQRLGEG FLKVFEAALRRWSGHNIIP* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,515.105 | ||
| Theoretical pI: | 9.763 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 55.993 | ||
| aromaticity | 0.085 | ||
| GRAVY | -1.032 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.338 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331227.1 | 5prime_partial | 130 | 1-393(+) |
Amino Acid sequence : | |||
| YPQKKKKKANRSEGMVLLDHLWDDVVAGPPPERGLKHLKKSFAQPLNIKDTGEGSNSKYQRSLSMPASPVTPGTPSPTSAKKENVWRSVFHPGSNLATRTVGANYYDRPEPNSPTVYDWL YSGDTRSKHH* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,515.105 | ||
| Theoretical pI: | 9.763 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 55.993 | ||
| aromaticity | 0.085 | ||
| GRAVY | -1.032 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.338 | ||
| sheet | 0.177 | ||