| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331230.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| DIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPE KYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGEIPD | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 16,861.733 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 103.131 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.128 | ||
| turn | 0.488 | ||
| sheet | 0.116 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331230.1 | 5prime_partial | 182 | 689-141(-) |
Amino Acid sequence : | |||
| VGDLPRPVGVHKHRQRLRDTDGVRDLHDAPPCEPVGNDALGRLPDNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLL EIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPIGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 16,861.733 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 103.131 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.128 | ||
| turn | 0.488 | ||
| sheet | 0.116 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331230.1 | 3prime_partial | 164 | 199-690(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTLS GRRPRASLPTGSQGGASCRSRTPSVSLSRCLCLWTPTGRGRSPT | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 16,861.733 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 103.131 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.128 | ||
| turn | 0.488 | ||
| sheet | 0.116 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331230.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| DIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPE KYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGEIPD | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 16,861.733 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 103.131 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.128 | ||
| turn | 0.488 | ||
| sheet | 0.116 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331230.1 | 5prime_partial | 182 | 689-141(-) |
Amino Acid sequence : | |||
| VGDLPRPVGVHKHRQRLRDTDGVRDLHDAPPCEPVGNDALGRLPDNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLL EIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPIGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 16,861.733 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 103.131 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.128 | ||
| turn | 0.488 | ||
| sheet | 0.116 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331230.1 | 3prime_partial | 164 | 199-690(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTLS GRRPRASLPTGSQGGASCRSRTPSVSLSRCLCLWTPTGRGRSPT | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 16,861.733 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 103.131 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.128 | ||
| turn | 0.488 | ||
| sheet | 0.116 | ||