Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331238.1 | 5prime_partial | 176 | 2-532(+) |
Amino Acid sequence : | |||
LVYLLDMKTGSRSKGATKKETKETLKPVDDRKVGKRKAAPKAAPRKAKKEKTKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSEDEKAPYEAKAAKKKAEYE KLMNAYNKKQQESSADEGDDASEKSASEVHDDEESVQEADEEDDDDNGDDDEDDDD* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,688.391 | ||
Theoretical pI: | 5.285 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 36.919 | ||
aromaticity | 0.057 | ||
GRAVY | -1.498 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.199 | ||
sheet | 0.290 |