Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331244.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
GEAGTGIAELIALEISKQTNVPLEEARRKIFLVDSKGLILKSRIESLQHFKRPWAHEHEPVTTLLDAVKTIKPTILIGSSGAGRTFTKEVVEAMSAINKKPVILALSNPTSQSECTAEEA YTWSEGRAIFASGSPFSPVEYNGQFYASGQANNAYIFPGLGLGLIISGAIRVHDDMLLAASEALAEQVSLENLAKGLIYPPFFHIRKNFS | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 22,769.769 | ||
Theoretical pI: | 6.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 48.966 | ||
aromaticity | 0.081 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.257 | ||
sheet | 0.305 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331244.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
GEAGTGIAELIALEISKQTNVPLEEARRKIFLVDSKGLILKSRIESLQHFKRPWAHEHEPVTTLLDAVKTIKPTILIGSSGAGRTFTKEVVEAMSAINKKPVILALSNPTSQSECTAEEA YTWSEGRAIFASGSPFSPVEYNGQFYASGQANNAYIFPGLGLGLIISGAIRVHDDMLLAASEALAEQVSLENLAKGLIYPPFFHIRKNFS | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 22,769.769 | ||
Theoretical pI: | 6.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 48.966 | ||
aromaticity | 0.081 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.257 | ||
sheet | 0.305 |