| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331254.1 | internal | 214 | 3-644(+) |
Amino Acid sequence : | |||
| HIGRDQARGLVGLMDFFCFSEACLIADIVQHFVDAKLEFDASYVYQDVNQAIQHVHKSGLAHRGILSDPQKYLVKNGQLLRFLRMLRENGKKLFLLTNSPFYFVDGGMRFMLEDSLGHQD SWRELFDVVIAKANKPQFYTSEHPFRYDVEKDTLAFTKVDTFLPNKIYYHGCLKAFLQITKWNGPEVIYFGDHLFSDLRGPSKSGWRTAAIIHE | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,757.055 | ||
| Theoretical pI: | 7.294 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 32.782 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.187 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331254.1 | internal | 214 | 3-644(+) |
Amino Acid sequence : | |||
| HIGRDQARGLVGLMDFFCFSEACLIADIVQHFVDAKLEFDASYVYQDVNQAIQHVHKSGLAHRGILSDPQKYLVKNGQLLRFLRMLRENGKKLFLLTNSPFYFVDGGMRFMLEDSLGHQD SWRELFDVVIAKANKPQFYTSEHPFRYDVEKDTLAFTKVDTFLPNKIYYHGCLKAFLQITKWNGPEVIYFGDHLFSDLRGPSKSGWRTAAIIHE | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,757.055 | ||
| Theoretical pI: | 7.294 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 32.782 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.187 | ||
| sheet | 0.229 | ||