| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331268.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
| KQKKVCVTGGTGFLGSWMIKRLLEDGYSVNATIRLHPERNRDISYITNLPGAAERLQIFNADLDNPETFVPAIKGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRR VVYTSSISAAAFGSPTNSDGLVDENSWTDVDLIRSLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDESHYQHLKDSSLVHVDDVVRAHIH LLEYPEAKGRYI | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 20,661.965 | ||
| Theoretical pI: | 11.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 92.287 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.234 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331268.1 | 5prime_partial | 175 | 2-529(+) |
Amino Acid sequence : | |||
| KAEKSVCDWRNRVSWIVDDQETLGRWLLCQRHNKTSSRAEQGHQLHHQPPRRGGATADLQRRPRQSGDIRASDKRMQRRLPHGSPSRLRRERIGGSKAEASHRRLTRHPAGLRRFQHCPP RGLHFQHLRRSLRLPHKLRRPRRREFVDRRGSDPQPEDLRRAVHRDENVDGESGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,661.965 | ||
| Theoretical pI: | 11.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 92.287 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.234 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331268.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
| KQKKVCVTGGTGFLGSWMIKRLLEDGYSVNATIRLHPERNRDISYITNLPGAAERLQIFNADLDNPETFVPAIKGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRR VVYTSSISAAAFGSPTNSDGLVDENSWTDVDLIRSLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDESHYQHLKDSSLVHVDDVVRAHIH LLEYPEAKGRYI | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 20,661.965 | ||
| Theoretical pI: | 11.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 92.287 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.234 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331268.1 | 5prime_partial | 175 | 2-529(+) |
Amino Acid sequence : | |||
| KAEKSVCDWRNRVSWIVDDQETLGRWLLCQRHNKTSSRAEQGHQLHHQPPRRGGATADLQRRPRQSGDIRASDKRMQRRLPHGSPSRLRRERIGGSKAEASHRRLTRHPAGLRRFQHCPP RGLHFQHLRRSLRLPHKLRRPRRREFVDRRGSDPQPEDLRRAVHRDENVDGESGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,661.965 | ||
| Theoretical pI: | 11.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 92.287 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.234 | ||
| sheet | 0.194 | ||