| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331273.1 | complete | 139 | 132-551(+) |
Amino Acid sequence : | |||
| MCIGWWIAIQRVDLYTIYMQPAPETPKHTLVMLAPGIPTVKPVVNSGRVRLRPVVIVSSDGPGGEVAAGVENAPPHVLLLRGGRRRRSRRHRTGRHRQRSLVLAIASLSSIFDVQRLGEG FLKVFEAALRRWSGHNIIP* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 12,871.217 | ||
| Theoretical pI: | 9.259 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
| Instability index: | 53.372 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.840 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.345 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331273.1 | complete | 116 | 569-219(-) |
Amino Acid sequence : | |||
| MVLLDHLWDDVVAGPPPERGLKHLKKSFAQPLNIKDTGEGSNSKYQRSLSMPASPVTPGTPSPTSAKKENVWRSVFHPGSNLATRTVGANYYDRPEPNSPTVYDWLYSGDTRSKHH* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,871.217 | ||
| Theoretical pI: | 9.259 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
| Instability index: | 53.372 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.840 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.345 | ||
| sheet | 0.181 | ||