| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331276.1 | 3prime_partial | 196 | 78-665(+) |
Amino Acid sequence : | |||
| MSSGGNTHWCYQCSQPIRPHSRNLVCPYCDGGFIQELPEVMGTHSGDGSVFGFVDPHHGIMDAFAALMRRRMVGRDPNFDVRTRSGIPTEGNVGIGARSPGQLLIFHGQSPVAIPSQDPF DFFFSSGHGIGPRRADFGDIFMGHGLHELIEQLSMNDRRGPPPAPRSAIDAMPTIKISQRHLNTDAHCPVCQDKFE | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,509.066 | ||
| Theoretical pI: | 6.394 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 56.434 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.316 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331276.1 | 3prime_partial | 196 | 78-665(+) |
Amino Acid sequence : | |||
| MSSGGNTHWCYQCSQPIRPHSRNLVCPYCDGGFIQELPEVMGTHSGDGSVFGFVDPHHGIMDAFAALMRRRMVGRDPNFDVRTRSGIPTEGNVGIGARSPGQLLIFHGQSPVAIPSQDPF DFFFSSGHGIGPRRADFGDIFMGHGLHELIEQLSMNDRRGPPPAPRSAIDAMPTIKISQRHLNTDAHCPVCQDKFE | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,509.066 | ||
| Theoretical pI: | 6.394 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 56.434 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.316 | ||
| sheet | 0.168 | ||