| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331278.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
| ITPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAA VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFP AINVND | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 24,350.142 | ||
| Theoretical pI: | 4.882 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.426 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.294 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331278.1 | 5prime_partial | 235 | 738-31(-) |
Amino Acid sequence : | |||
| IIDIDGRKKQSAISLHLIQPLHPSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGF ALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 24,350.142 | ||
| Theoretical pI: | 4.882 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.426 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.294 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331278.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
| ITPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAA VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFP AINVND | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 24,350.142 | ||
| Theoretical pI: | 4.882 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.426 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.294 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331278.1 | 5prime_partial | 235 | 738-31(-) |
Amino Acid sequence : | |||
| IIDIDGRKKQSAISLHLIQPLHPSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGF ALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 24,350.142 | ||
| Theoretical pI: | 4.882 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.426 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.294 | ||
| sheet | 0.323 | ||