| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331279.1 | internal | 214 | 2-643(+) |
Amino Acid sequence : | |||
| KLIIPPPLSPAARSSPRPTHSRPPPPLKAAAPSHLPPPLPPNWPHLLPQTRLPPLRRRVLPNSSGGMLRHKRRRLGQSTSHPRRQVHRLQQHLHARRSLRRTPPQSPPHRRPGGALHFPP QRLPTNSARRSESPAPQPPQRIRFRGEIEADIISTHLQQHDEDACRGKIFLRGRRGERGGAQIPEADXQCFRDCAGIQSAGFPAFSAADRLWRF | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,390.856 | ||
| Theoretical pI: | 9.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.342 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.258 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331279.1 | internal | 214 | 3-644(+) |
Amino Acid sequence : | |||
| NSSSRRRYRLPPDPAPALPILGHLHLLKQPLHRTFLRLSLRTGPIFSLKLGFRRCVVVSSPTLVEECFATNDVVLANRPPILVDKYIGYNNTSMPGAPYGEHLRSLRRIAAQEVLSTSRL NAFLQIRQDEVNRLLLNLLKGSDSEVKLRPILSQLTFSNMMRMLAGERYSFEEDEESVEGRRFRKLXHNVFEIAQASNPQDFLPFLQRIDYGGF | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,390.856 | ||
| Theoretical pI: | 9.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.342 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.258 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331279.1 | internal | 214 | 2-643(+) |
Amino Acid sequence : | |||
| KLIIPPPLSPAARSSPRPTHSRPPPPLKAAAPSHLPPPLPPNWPHLLPQTRLPPLRRRVLPNSSGGMLRHKRRRLGQSTSHPRRQVHRLQQHLHARRSLRRTPPQSPPHRRPGGALHFPP QRLPTNSARRSESPAPQPPQRIRFRGEIEADIISTHLQQHDEDACRGKIFLRGRRGERGGAQIPEADXQCFRDCAGIQSAGFPAFSAADRLWRF | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,390.856 | ||
| Theoretical pI: | 9.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.342 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.258 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331279.1 | internal | 214 | 3-644(+) |
Amino Acid sequence : | |||
| NSSSRRRYRLPPDPAPALPILGHLHLLKQPLHRTFLRLSLRTGPIFSLKLGFRRCVVVSSPTLVEECFATNDVVLANRPPILVDKYIGYNNTSMPGAPYGEHLRSLRRIAAQEVLSTSRL NAFLQIRQDEVNRLLLNLLKGSDSEVKLRPILSQLTFSNMMRMLAGERYSFEEDEESVEGRRFRKLXHNVFEIAQASNPQDFLPFLQRIDYGGF | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 24,390.856 | ||
| Theoretical pI: | 9.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 65.342 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.258 | ||
| sheet | 0.282 | ||