Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331281.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
RMRKPFLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGVFTDKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSI TATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEESEGKLKGILGYTEDDVVSTD | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 11,604.476 | ||
Theoretical pI: | 10.112 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 43.991 | ||
aromaticity | 0.111 | ||
GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.278 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331281.1 | 3prime_partial | 108 | 326-3(-) |
Amino Acid sequence : | |||
MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAAFSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRKGFLI | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,604.476 | ||
Theoretical pI: | 10.112 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 43.991 | ||
aromaticity | 0.111 | ||
GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.278 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331281.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
RMRKPFLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGVFTDKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSI TATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEESEGKLKGILGYTEDDVVSTD | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 11,604.476 | ||
Theoretical pI: | 10.112 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 43.991 | ||
aromaticity | 0.111 | ||
GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.278 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331281.1 | 3prime_partial | 108 | 326-3(-) |
Amino Acid sequence : | |||
MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAAFSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRKGFLI | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,604.476 | ||
Theoretical pI: | 10.112 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 43.991 | ||
aromaticity | 0.111 | ||
GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.278 | ||
sheet | 0.259 |