| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331281.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
| RMRKPFLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGVFTDKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSI TATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEESEGKLKGILGYTEDDVVSTD | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 11,604.476 | ||
| Theoretical pI: | 10.112 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 43.991 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.278 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331281.1 | 3prime_partial | 108 | 326-3(-) |
Amino Acid sequence : | |||
| MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAAFSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRKGFLI | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,604.476 | ||
| Theoretical pI: | 10.112 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 43.991 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.278 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331281.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
| RMRKPFLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGVFTDKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSI TATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEESEGKLKGILGYTEDDVVSTD | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 11,604.476 | ||
| Theoretical pI: | 10.112 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 43.991 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.278 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331281.1 | 3prime_partial | 108 | 326-3(-) |
Amino Acid sequence : | |||
| MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAAFSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRKGFLI | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,604.476 | ||
| Theoretical pI: | 10.112 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 43.991 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.278 | ||
| sheet | 0.259 | ||