| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331289.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| EIGHGSVLIRHPNSVVREEESEASSLSVDKQYTLNSRLKSFHGFTDDTGAYSSSKANEKIKKSVYPEALQEQTRRDKDHVVKLPILAHHNSPLCYVDLQDIVNFDIFSSHLTNDEQQQLM KLLPSVDTFDAPYSLNSMFGSIEFNQNLSSFQNLIAEGVFDNSFGGVRTEDCRILKRLVLSDLAKSKWVEQHTSFKDSKCKSSTKLVGGYDDFEIVTGANLKRSRDGLHQKNTGSKAMIK SP | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 15,027.345 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.772 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.288 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331289.1 | 5prime_partial | 132 | 726-328(-) |
Amino Acid sequence : | |||
| GLLIIAFDPVFFWCSPSRDRFKFAPVTISKSSYPPTNLVLLLHFESLKDVCCSTHFDFAKSLNTSRFKILQSSVLTPPNELSKTPSAIRFWKEDRFWLNSMLPNMLLRLYGASKVSTEGN SFINCCCSSFVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,027.345 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.772 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.288 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331289.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| EIGHGSVLIRHPNSVVREEESEASSLSVDKQYTLNSRLKSFHGFTDDTGAYSSSKANEKIKKSVYPEALQEQTRRDKDHVVKLPILAHHNSPLCYVDLQDIVNFDIFSSHLTNDEQQQLM KLLPSVDTFDAPYSLNSMFGSIEFNQNLSSFQNLIAEGVFDNSFGGVRTEDCRILKRLVLSDLAKSKWVEQHTSFKDSKCKSSTKLVGGYDDFEIVTGANLKRSRDGLHQKNTGSKAMIK SP | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 15,027.345 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.772 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.288 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331289.1 | 5prime_partial | 132 | 726-328(-) |
Amino Acid sequence : | |||
| GLLIIAFDPVFFWCSPSRDRFKFAPVTISKSSYPPTNLVLLLHFESLKDVCCSTHFDFAKSLNTSRFKILQSSVLTPPNELSKTPSAIRFWKEDRFWLNSMLPNMLLRLYGASKVSTEGN SFINCCCSSFVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,027.345 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.772 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.288 | ||
| sheet | 0.205 | ||