| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331293.1 | 5prime_partial | 186 | 1-561(+) |
Amino Acid sequence : | |||
| QDASTHSSEEYVEIPSDSGITFNVKPKMKALEIAEKARDAILSGKFDQVRVNLPNGDMVGHTGDIEATIVACKAADEAVKMILDAVEKVGGIYVVTADHGNAEDMVKRNKKGEPLLDKNG QIQILTSHTLEPVPVAIGGPGLAPGVRFRSDVPNGGLANVAATVMNLHGFEAPSDYETTLIEVVDK* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 10,959.771 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 51.489 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.699 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.298 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331293.1 | 3prime_partial | 104 | 314-3(-) |
Amino Acid sequence : | |||
| MSSALPWSAVTTYIPPTFSTASRIILTASSAALQATIVASISPVCPTMSPLGRLTRTWSNLPLRMASLAFSAISKAFILGLTLKVIPLSLGISTYSSELWVEAS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,959.771 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 51.489 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.699 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.298 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331293.1 | 5prime_partial | 186 | 1-561(+) |
Amino Acid sequence : | |||
| QDASTHSSEEYVEIPSDSGITFNVKPKMKALEIAEKARDAILSGKFDQVRVNLPNGDMVGHTGDIEATIVACKAADEAVKMILDAVEKVGGIYVVTADHGNAEDMVKRNKKGEPLLDKNG QIQILTSHTLEPVPVAIGGPGLAPGVRFRSDVPNGGLANVAATVMNLHGFEAPSDYETTLIEVVDK* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 10,959.771 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 51.489 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.699 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.298 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331293.1 | 3prime_partial | 104 | 314-3(-) |
Amino Acid sequence : | |||
| MSSALPWSAVTTYIPPTFSTASRIILTASSAALQATIVASISPVCPTMSPLGRLTRTWSNLPLRMASLAFSAISKAFILGLTLKVIPLSLGISTYSSELWVEAS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,959.771 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 51.489 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.699 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.298 | ||
| sheet | 0.308 | ||